Lineage for d1sova1 (1sov A:15-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848951Species Toxoplasma gondii [TaxId:5811] [230331] (2 PDB entries)
  8. 2848952Domain d1sova1: 1sov A:15-163 [230332]
    Other proteins in same PDB: d1sova2, d1sovb2
    automated match to d1pzga1

Details for d1sova1

PDB Entry: 1sov (more details), 1.9 Å

PDB Description: Toxoplasma gondii bradyzoite-specific LDH (LDH2) apo form
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1sova1:

Sequence, based on SEQRES records: (download)

>d1sova1 c.2.1.0 (A:15-163) automated matches {Toxoplasma gondii [TaxId: 5811]}
gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
vsvtsanqyekiagsdvviitagltkvpgksdkewsrndllpfnakiirevaqgvkkycp
lafvivvtnpldcmvkcfheasglpknmvcgm

Sequence, based on observed residues (ATOM records): (download)

>d1sova1 c.2.1.0 (A:15-163) automated matches {Toxoplasma gondii [TaxId: 5811]}
gtvsrrkkiamigsgmiggtmgylcvlreladvvlfdvvtgmpegkalddsqatsiadtn
vsvtsanqyekiagsdvviitagltkvpsrndllpfnakiirevaqgvkkycplafvivv
tnpldcmvkcfheasglpknmvcgm

SCOPe Domain Coordinates for d1sova1:

Click to download the PDB-style file with coordinates for d1sova1.
(The format of our PDB-style files is described here.)

Timeline for d1sova1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sova2