SCOP 1.71: Domain d1occo1: 1occ O:91-227

Lineage for d1occo1 (1occ O:91-227)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49545] (7 PDB entries)

8. Domain d1occo1: 1occ O:91-227 [23032]
   Other proteins in same PDB: d1occa_, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
   complexed with cu, hea, mg, zn

Details for d1occo1

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occo1:

Sequence; same for both SEQRES and ATOM records:

>d1occo1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

Timeline for d1occo1:

• d1occo1 first appeared (with stable ids) in SCOP 1.55
  
• d1occo1 appears in SCOP 1.69
  
• d1occo1 appears in SCOP 1.73
  
• d1occo1 appears in the current release, SCOPe 2.08