Lineage for d1occb1 (1occ B:91-227)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303168Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1303169Protein Cytochrome c oxidase [49544] (4 species)
  7. 1303170Species Cow (Bos taurus) [TaxId:9913] [49545] (24 PDB entries)
  8. 1303213Domain d1occb1: 1occ B:91-227 [23031]
    Other proteins in same PDB: d1occa_, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occg_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occt_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_
    complexed with cu, hea, mg, zn

Details for d1occb1

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (B:) cytochrome c oxidase

SCOPe Domain Sequences for d1occb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occb1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d1occb1:

Click to download the PDB-style file with coordinates for d1occb1.
(The format of our PDB-style files is described here.)

Timeline for d1occb1: