SCOPe 2.03: Domain d4nbzb_: 4nbz B:

Lineage for d4nbzb_ (4nbz B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (4 PDB entries)

8. Domain d4nbzb_: 4nbz B: [230292]
   automated match to d4nbzd_

Details for d4nbzb_

PDB Entry: 4nbz, 1.75 Å

PDB Description: Crystal Structure of TcdA-A1 Bound to A26.8 VHH

PDB Compounds: (B:) a26.8 vhh

SCOPe Domain Sequences for d4nbzb_:

Sequence; same for both SEQRES and ATOM records:

>d4nbzb_ b.1.1.0 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyya
dsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqvt
vssgseqklise

Timeline for d4nbzb_:

• d4nbzb_ is new in SCOPe 2.03-stable
  
• d4nbzb_ appears in SCOPe 2.04
  
• d4nbzb_ appears in the current release, SCOPe 2.08