Lineage for d2occo1 (2occ O:91-227)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11128Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 11129Protein Cytochrome c oxidase [49544] (3 species)
  7. 11130Species Cow (Bos taurus) [TaxId:9913] [49545] (5 PDB entries)
  8. 11132Domain d2occo1: 2occ O:91-227 [23028]
    Other proteins in same PDB: d2occa1, d2occb2, d2occc1, d2occd1, d2occe_, d2occf_, d2occg1, d2occh_, d2occi1, d2occj1, d2occk1, d2occl1, d2occm1, d2occn1, d2occo2, d2occp1, d2occq1, d2occr_, d2occs_, d2occt1, d2occu_, d2occv1, d2occw1, d2occx1, d2occy1, d2occz1

Details for d2occo1

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d2occo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occo1 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus)}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOP Domain Coordinates for d2occo1:

Click to download the PDB-style file with coordinates for d2occo1.
(The format of our PDB-style files is described here.)

Timeline for d2occo1: