SCOPe 2.08: Domain d4kkxa_: 4kkx A:

Lineage for d4kkxa_ (4kkx A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Trp synthase alpha-subunit [51388] (9 species)

7. Species Salmonella enterica [TaxId:90371] [229811] (6 PDB entries)

8. Domain d4kkxa_: 4kkx A: [230258]
   Other proteins in same PDB: d4kkxb_
   automated match to d1k8ya_
   complexed with aq3, edo, f6f, na, peg, pge

Details for d4kkxa_

PDB Entry: 4kkx, 1.77 Å

PDB Description: crystal structure of tryptophan synthase from salmonella typhimurium with 2-aminophenol quinonoid in the beta site and the f6 inhibitor in the alpha site

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d4kkxa_:

Sequence; same for both SEQRES and ATOM records:

>d4kkxa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella enterica [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

Timeline for d4kkxa_:

• d4kkxa_ first appeared in SCOPe 2.03
  
• d4kkxa_ appears in SCOPe 2.07