Lineage for d1fftb1 (1fft B:118-283)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457946Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 457975Protein Quinol oxidase (CyoA) [49542] (1 species)
  7. 457976Species Escherichia coli [TaxId:562] [49543] (3 PDB entries)
  8. 457979Domain d1fftb1: 1fft B:118-283 [23025]
    Other proteins in same PDB: d1ffta_, d1fftb2, d1fftc_, d1fftf_, d1fftg2, d1ffth_

Details for d1fftb1

PDB Entry: 1fft (more details), 3.5 Å

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftb1 b.6.1.2 (B:118-283) Quinol oxidase (CyoA) {Escherichia coli}
kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip
rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak
akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfma

SCOP Domain Coordinates for d1fftb1:

Click to download the PDB-style file with coordinates for d1fftb1.
(The format of our PDB-style files is described here.)

Timeline for d1fftb1: