Lineage for d1cywa_ (1cyw A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528012Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 1528114Protein Quinol oxidase (CyoA) [49542] (1 species)
  7. 1528115Species Escherichia coli [TaxId:562] [49543] (3 PDB entries)
  8. 1528117Domain d1cywa_: 1cyw A: [23024]

Details for d1cywa_

PDB Entry: 1cyw (more details), 2.5 Å

PDB Description: quinol oxidase (periplasmic fragment of subunit ii) (cyoa)
PDB Compounds: (A:) cyoa

SCOPe Domain Sequences for d1cywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cywa_ b.6.1.2 (A:) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]}
kpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffiprlgsqiy
amagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvakakqspnt
msdmaafeklaapseynqveyfsnvkpdlfadvinkfma

SCOPe Domain Coordinates for d1cywa_:

Click to download the PDB-style file with coordinates for d1cywa_.
(The format of our PDB-style files is described here.)

Timeline for d1cywa_: