Lineage for d1cyw__ (1cyw -)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224664Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 224689Protein Quinol oxidase (CyoA) [49542] (1 species)
  7. 224690Species Escherichia coli [TaxId:562] [49543] (3 PDB entries)
  8. 224692Domain d1cyw__: 1cyw - [23024]

Details for d1cyw__

PDB Entry: 1cyw (more details), 2.5 Å

PDB Description: quinol oxidase (periplasmic fragment of subunit ii) (cyoa)

SCOP Domain Sequences for d1cyw__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyw__ b.6.1.2 (-) Quinol oxidase (CyoA) {Escherichia coli}
kpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffiprlgsqiy
amagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvakakqspnt
msdmaafeklaapseynqveyfsnvkpdlfadvinkfma

SCOP Domain Coordinates for d1cyw__:

Click to download the PDB-style file with coordinates for d1cyw__.
(The format of our PDB-style files is described here.)

Timeline for d1cyw__: