![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.6: Cupredoxins [49502] (1 superfamily) |
![]() | Superfamily b.6.1: Cupredoxins [49503] (4 families) ![]() |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins) |
![]() | Protein Quinol oxidase (CyoA) [49542] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49543] (3 PDB entries) |
![]() | Domain d1cyx__: 1cyx - [23023] |
PDB Entry: 1cyx (more details), 2.3 Å
SCOP Domain Sequences for d1cyx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyx__ b.6.1.2 (-) Quinol oxidase (CyoA) {Escherichia coli} kpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmhsffiprlgsqiy amagmqtrlhlianepgtydgicaeicgpghsgmkfkaiatpdraafdqwvakakqspnt msdmaafeklaapseynqveyfsnvkpdlfadvinkfm
Timeline for d1cyx__: