Lineage for d1cyx__ (1cyx -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11128Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 11156Protein Quinol oxidase (CyoA) [49542] (1 species)
  7. 11157Species Escherichia coli [TaxId:562] [49543] (3 PDB entries)
  8. 11158Domain d1cyx__: 1cyx - [23023]

Details for d1cyx__

PDB Entry: 1cyx (more details), 2.3 Å

PDB Description: quinol oxidase (periplasmic fragment of subunit ii with engineered cu- a binding site)(cyoa)

SCOP Domain Sequences for d1cyx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyx__ b.6.1.2 (-) Quinol oxidase (CyoA) {Escherichia coli}
kpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmhsffiprlgsqiy
amagmqtrlhlianepgtydgicaeicgpghsgmkfkaiatpdraafdqwvakakqspnt
msdmaafeklaapseynqveyfsnvkpdlfadvinkfm

SCOP Domain Coordinates for d1cyx__:

Click to download the PDB-style file with coordinates for d1cyx__.
(The format of our PDB-style files is described here.)

Timeline for d1cyx__: