Lineage for d1cyx__ (1cyx -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) 
Protein Quinol oxidase (CyoA) [49542] (1 species) Species Escherichia coli [TaxId:562] [49543] (3 PDB entries) 
Domain d1cyx__: 1cyx - [23023]
Details for d1cyx__
PDB Entry: 1cyx (more details), 2.3 Å
PDB Description: quinol oxidase (periplasmic fragment of subunit ii with engineered cu- a binding site)(cyoa)
SCOP Domain Sequences for d1cyx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyx__ b.6.1.2 (-) Quinol oxidase (CyoA) {Escherichia coli}
kpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmhsffiprlgsqiy
amagmqtrlhlianepgtydgicaeicgpghsgmkfkaiatpdraafdqwvakakqspnt
msdmaafeklaapseynqveyfsnvkpdlfadvinkfm
SCOP Domain Coordinates for d1cyx__:
Click to download the PDB-style file with coordinates for d1cyx__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cyx__:
- d1cyx__ appears in SCOP 1.57
- d1cyx__ appears in the current release, SCOPe 2.08, called d1cyxa_
View in 3D