Lineage for d3wbrd_ (3wbr D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002571Domain d3wbrd_: 3wbr D: [230203]
    Other proteins in same PDB: d3wbra2, d3wbrb2, d3wbrc2
    automated match to d2ox8a_

Details for d3wbrd_

PDB Entry: 3wbr (more details), 2.2 Å

PDB Description: crystal structure of carbohydrate recognition domain of blood dendritic cell antigen-2 (bdca2) lectin (crystal form-3)
PDB Compounds: (D:) C-type lectin domain family 4 member C

SCOPe Domain Sequences for d3wbrd_:

Sequence, based on SEQRES records: (download)

>d3wbrd_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchvpq
ksickmkk

Sequence, based on observed residues (ATOM records): (download)

>d3wbrd_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsewgwndihchvpqks
ickmkk

SCOPe Domain Coordinates for d3wbrd_:

Click to download the PDB-style file with coordinates for d3wbrd_.
(The format of our PDB-style files is described here.)

Timeline for d3wbrd_: