Lineage for d3wbra1 (3wbr A:83-210)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 2559917Domain d3wbra1: 3wbr A:83-210 [230202]
    Other proteins in same PDB: d3wbra2, d3wbrb2, d3wbrc2
    automated match to d2ox8a_

Details for d3wbra1

PDB Entry: 3wbr (more details), 2.2 Å

PDB Description: crystal structure of carbohydrate recognition domain of blood dendritic cell antigen-2 (bdca2) lectin (crystal form-3)
PDB Compounds: (A:) C-type lectin domain family 4 member C

SCOPe Domain Sequences for d3wbra1:

Sequence, based on SEQRES records: (download)

>d3wbra1 d.169.1.0 (A:83-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwndihchvpq
ksickmkk

Sequence, based on observed residues (ATOM records): (download)

>d3wbra1 d.169.1.0 (A:83-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyfl
glsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrseewgwndihchvpqk
sickmkk

SCOPe Domain Coordinates for d3wbra1:

Click to download the PDB-style file with coordinates for d3wbra1.
(The format of our PDB-style files is described here.)

Timeline for d3wbra1: