Lineage for d4np9a_ (4np9 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529155Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529156Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1529361Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 1529362Protein automated matches [190497] (3 species)
    not a true protein
  7. 1529391Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (8 PDB entries)
  8. 1529401Domain d4np9a_: 4np9 A: [230171]
    automated match to d4lt7a_
    complexed with i3p, so4

Details for d4np9a_

PDB Entry: 4np9 (more details), 1.92 Å

PDB Description: structure of rabphilin c2a domain bound to ip3
PDB Compounds: (A:) rabphilin-3a

SCOPe Domain Sequences for d4np9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4np9a_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktl
rntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrkn
fniclervi

SCOPe Domain Coordinates for d4np9a_:

Click to download the PDB-style file with coordinates for d4np9a_.
(The format of our PDB-style files is described here.)

Timeline for d4np9a_: