Lineage for d4m1dl1 (4m1d L:1-106A)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765433Domain d4m1dl1: 4m1d L:1-106A [230160]
    Other proteins in same PDB: d4m1dh1, d4m1dh2, d4m1di1, d4m1di2
    automated match to d4m1dm1
    complexed with gol

Details for d4m1dl1

PDB Entry: 4m1d (more details), 1.8 Å

PDB Description: Crystal structure of anti-HIV-1 Fab 447-52D in complex with V3 cyclic peptide MN
PDB Compounds: (L:) Fab mAb 447-52D Light Chain

SCOPe Domain Sequences for d4m1dl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1dl1 b.1.1.0 (L:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvl

SCOPe Domain Coordinates for d4m1dl1:

Click to download the PDB-style file with coordinates for d4m1dl1.
(The format of our PDB-style files is described here.)

Timeline for d4m1dl1: