SCOPe 2.05: Domain d4m1dl1: 4m1d L:1-106A

Lineage for d4m1dl1 (4m1d L:1-106A)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4m1dl1: 4m1d L:1-106A [230160]
   Other proteins in same PDB: d4m1dh1, d4m1dh2, d4m1di1, d4m1di2
   automated match to d4m1dm1
   complexed with gol

Details for d4m1dl1

PDB Entry: 4m1d, 1.8 Å

PDB Description: Crystal structure of anti-HIV-1 Fab 447-52D in complex with V3 cyclic peptide MN

PDB Compounds: (L:) Fab mAb 447-52D Light Chain

SCOPe Domain Sequences for d4m1dl1:

Sequence; same for both SEQRES and ATOM records:

>d4m1dl1 b.1.1.0 (L:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgip
drfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvl

Timeline for d4m1dl1:

• d4m1dl1 first appeared in SCOPe 2.03
  
• d4m1dl1 appears in SCOPe 2.04
  
• d4m1dl1 appears in SCOPe 2.06
  
• d4m1dl1 appears in the current release, SCOPe 2.08