Lineage for d4lsla2 (4lsl A:430-548)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607696Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1607697Protein automated matches [190396] (26 species)
    not a true protein
  7. 1607778Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (14 PDB entries)
  8. 1607787Domain d4lsla2: 4lsl A:430-548 [230149]
    Other proteins in same PDB: d4lsla1, d4lslb_
    automated match to d2zd1a2
    complexed with 1yq

Details for d4lsla2

PDB Entry: 4lsl (more details), 2.69 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with (e)- 3-(3-(4-chloro-2-(2-(2,4-dioxo-3,4-dihydropyrimidin-1(2h)-yl)ethoxy) phenoxy)phenyl)acrylonitrile (jlj476), a non-nucleoside inhibitor
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4lsla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsla2 c.55.3.0 (A:430-548) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqv

SCOPe Domain Coordinates for d4lsla2:

Click to download the PDB-style file with coordinates for d4lsla2.
(The format of our PDB-style files is described here.)

Timeline for d4lsla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lsla1
View in 3D
Domains from other chains:
(mouse over for more information)
d4lslb_