Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [225129] (16 PDB entries) |
Domain d4lsla2: 4lsl A:430-548 [230149] Other proteins in same PDB: d4lsla1, d4lslb_ automated match to d2zd1a2 complexed with 1yq |
PDB Entry: 4lsl (more details), 2.69 Å
SCOPe Domain Sequences for d4lsla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lsla2 c.55.3.0 (A:430-548) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqv
Timeline for d4lsla2: