SCOPe 2.06: Domain d4l3ck1: 4l3c K:1-181

Lineage for d4l3ck1 (4l3c K:1-181)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (101 PDB entries)
   Uniprot P01892 25-298

8. Domain d4l3ck1: 4l3c K:1-181 [230087]
   Other proteins in same PDB: d4l3ca2, d4l3cb_, d4l3cc2, d4l3cd_, d4l3ce2, d4l3cf_, d4l3cg2, d4l3ch_, d4l3ci2, d4l3cj_, d4l3ck2, d4l3cl_, d4l3cm2, d4l3cn_, d4l3co2, d4l3cp_, d4l3cq2, d4l3cr_, d4l3cs2, d4l3ct_, d4l3cu2, d4l3cv_, d4l3cw2, d4l3cx_, d4l3cy2, d4l3cz_
   automated match to d1ogaa2
   complexed with cl, gol; mutant

Details for d4l3ck1

PDB Entry: 4l3c, 2.64 Å

PDB Description: Structure of HLA-A2 in complex with D76N b2m mutant and NY-ESO1 double mutant

PDB Compounds: (K:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d4l3ck1:

Sequence; same for both SEQRES and ATOM records:

>d4l3ck1 d.19.1.1 (K:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d4l3ck1:

• d4l3ck1 first appeared in SCOPe 2.03
  
• d4l3ck1 appears in SCOPe 2.05
  
• d4l3ck1 appears in SCOPe 2.07
  
• d4l3ck1 appears in the current release, SCOPe 2.08