Lineage for d1aznb_ (1azn B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Azurin [49530] (6 species) 
Species Pseudomonas aeruginosa [TaxId:287] [49533] (22 PDB entries) 
Domain d1aznb_: 1azn B: [23004]
Details for d1aznb_
PDB Entry: 1azn (more details), 2.6 Å
PDB Description: crystal structure of the azurin mutant phe114ala from pseudomonas aeruginosa at 2.6 angstroms resolution
SCOP Domain Sequences for d1aznb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aznb_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctapghsal
mkgtltlk
SCOP Domain Coordinates for d1aznb_:
Click to download the PDB-style file with coordinates for d1aznb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aznb_:
- d1aznb_ appears in SCOP 1.57
- d1aznb_ appears in the current release, SCOPe 2.08
View in 3D
