SCOPe 2.06: Domain d4c9cb1: 4c9c B:2-160

Lineage for d4c9cb1 (4c9c B:2-160)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Fragaria x [TaxId:3747] [228292] (4 PDB entries)

8. Domain d4c9cb1: 4c9c B:2-160 [230004]
   Other proteins in same PDB: d4c9ca2, d4c9cb2
   automated match to d4c9ca_
   complexed with gol, so4

Details for d4c9cb1

PDB Entry: 4c9c, 2.2 Å

PDB Description: Crystal Structure of the Strawberry Pathogenesis-Related 10 (PR-10) Fra a 1E protein (Form A)

PDB Compounds: (B:) Major strawberry allergen Fra a 1-E

SCOPe Domain Sequences for d4c9cb1:

Sequence, based on SEQRES records:

>d4c9cb1 d.129.3.0 (B:2-160) automated matches {Fragaria x [TaxId: 3747]}
gvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkitfge
gshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttsky
htkgdveikeehvkagkekaahlfkliegylkdhpseyn

Sequence, based on observed residues (ATOM records):

>d4c9cb1 d.129.3.0 (B:2-160) automated matches {Fragaria x [TaxId: 3747]}
gvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkitfgg
yvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttskyhtkgd
veikeehvkagkekaahlfkliegylkdhpseyn

Timeline for d4c9cb1:

• d4c9cb1 first appeared in SCOPe 2.03, called d4c9cb_
  
• d4c9cb1 was called d4c9cb_ in SCOPe 2.05
  
• d4c9cb1 appears in SCOPe 2.07
  
• d4c9cb1 appears in the current release, SCOPe 2.08