Lineage for d4c9cb_ (4c9c B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669085Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1669378Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1669379Protein automated matches [190218] (19 species)
    not a true protein
  7. 1669450Species Fragaria x [TaxId:3747] [228292] (4 PDB entries)
  8. 1669452Domain d4c9cb_: 4c9c B: [230004]
    automated match to d4c9ca_
    complexed with gol, so4

Details for d4c9cb_

PDB Entry: 4c9c (more details), 2.2 Å

PDB Description: Crystal Structure of the Strawberry Pathogenesis-Related 10 (PR-10) Fra a 1E protein (Form A)
PDB Compounds: (B:) Major strawberry allergen Fra a 1-E

SCOPe Domain Sequences for d4c9cb_:

Sequence, based on SEQRES records: (download)

>d4c9cb_ d.129.3.0 (B:) automated matches {Fragaria x [TaxId: 3747]}
amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
fgegshygyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiiktt
skyhtkgdveikeehvkagkekaahlfkliegylkdhpseyn

Sequence, based on observed residues (ATOM records): (download)

>d4c9cb_ d.129.3.0 (B:) automated matches {Fragaria x [TaxId: 3747]}
amagvytyeneftsdipapklfkafvldadnlipkiapqavkcaeilegdggpgtikkit
fggyvkhkihsidkvnhtysysliegdalseniekidyetklvsaphggtiikttskyht
kgdveikeehvkagkekaahlfkliegylkdhpseyn

SCOPe Domain Coordinates for d4c9cb_:

Click to download the PDB-style file with coordinates for d4c9cb_.
(The format of our PDB-style files is described here.)

Timeline for d4c9cb_: