Lineage for d4nvaa_ (4nva A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741332Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 1741333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (176 PDB entries)
    Uniprot P00431
  8. 1741387Domain d4nvaa_: 4nva A: [229973]
    automated match to d1kxna_
    complexed with hem

Details for d4nvaa_

PDB Entry: 4nva (more details), 1.57 Å

PDB Description: predicting protein conformational response in prospective ligand discovery
PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d4nvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nvaa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d4nvaa_:

Click to download the PDB-style file with coordinates for d4nvaa_.
(The format of our PDB-style files is described here.)

Timeline for d4nvaa_: