SCOPe 2.06: Domain d4mq7a2: 4mq7 A:184-277

Lineage for d4mq7a2 (4mq7 A:184-277)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4mq7a2: 4mq7 A:184-277 [229910]
   Other proteins in same PDB: d4mq7a1, d4mq7a3, d4mq7b_
   automated match to d3hujc2
   complexed with cis, nag

Details for d4mq7a2

PDB Entry: 4mq7, 2.6 Å

PDB Description: structure of human cd1d-sulfatide

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d, Cd1d1 protein

SCOPe Domain Sequences for d4mq7a2:

Sequence; same for both SEQRES and ATOM records:

>d4mq7a2 b.1.1.0 (A:184-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Timeline for d4mq7a2:

• d4mq7a2 first appeared in SCOPe 2.03
  
• d4mq7a2 appears in SCOPe 2.05
  
• d4mq7a2 appears in SCOPe 2.07
  
• d4mq7a2 appears in the current release, SCOPe 2.08