SCOPe 2.03: Domain d4m1wc_: 4m1w C:

Lineage for d4m1wc_ (4m1w C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)

8. Domain d4m1wc_: 4m1w C: [229885]
   automated match to d4lrwa_
   complexed with 21r, gdp, mg

Details for d4m1wc_

PDB Entry: 4m1w, 1.58 Å

PDB Description: crystal structure of small molecule vinylsulfonamide covalently bound to k-ras g12c

PDB Compounds: (C:) K-Ras GTPase

SCOPe Domain Sequences for d4m1wc_:

Sequence, based on SEQRES records:

>d4m1wc_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
qeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Sequence, based on observed residues (ATOM records):

>d4m1wc_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvsyrkqvvidgetslldildtagqeysamrdq
ymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrtvdtkqa
qdlarsygipfietsaktrqgvddafytlvreirkhk

Timeline for d4m1wc_:

• d4m1wc_ is new in SCOPe 2.03-stable
  
• d4m1wc_ appears in SCOPe 2.04
  
• d4m1wc_ appears in the current release, SCOPe 2.08