SCOPe 2.04: Domain d4lx0c_: 4lx0 C:

Lineage for d4lx0c_ (4lx0 C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries)

8. Domain d4lx0c_: 4lx0 C: [229873]
   automated match to d4lwza_
   complexed with bef, gdp, gol, mg

Details for d4lx0c_

PDB Entry: 4lx0, 2.19 Å

PDB Description: Crystal structure of Myo5b globular tail domain in complex with active Rab11a

PDB Compounds: (C:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d4lx0c_:

Sequence; same for both SEQRES and ATOM records:

>d4lx0c_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs

Timeline for d4lx0c_:

• d4lx0c_ first appeared in SCOPe 2.03
  
• d4lx0c_ appears in SCOPe 2.05
  
• d4lx0c_ appears in the current release, SCOPe 2.08