Lineage for d4lx0a_ (4lx0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1847028Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)
  8. 1847200Domain d4lx0a_: 4lx0 A: [229872]
    automated match to d4lwza_
    complexed with bef, gdp, gol, mg

Details for d4lx0a_

PDB Entry: 4lx0 (more details), 2.19 Å

PDB Description: Crystal structure of Myo5b globular tail domain in complex with active Rab11a
PDB Compounds: (A:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d4lx0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lx0a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivs

SCOPe Domain Coordinates for d4lx0a_:

Click to download the PDB-style file with coordinates for d4lx0a_.
(The format of our PDB-style files is described here.)

Timeline for d4lx0a_: