Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Caulobacter crescentus [TaxId:190650] [229832] (1 PDB entry) |
Domain d4irxb1: 4irx B:39-325 [229833] Other proteins in same PDB: d4irxa2, d4irxb2 automated match to d2fn8a_ complexed with ins |
PDB Entry: 4irx (more details), 1.45 Å
SCOPe Domain Sequences for d4irxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irxb1 c.93.1.0 (B:39-325) automated matches {Caulobacter crescentus [TaxId: 190650]} evvvsfndlsqpffvamrreledeaaklgvkvqvldaqnnsskqisdlqaaavqgakvvi vaptdskalagaaddlveqgvavisvdrniaggktavphvgadnvaggramadwvvktyp agarvvvitndpgssssiervkgvhdglaaggpafkivteqtanskrdqaltvtqnilts mrdtppdvilclnddmamgaleavraagldsakvkvigfdaipealarikagemvatveq npglqirtalrqavdkiksgaalksvslkpvlitsgnlteasrigem
Timeline for d4irxb1: