Lineage for d4ft8a2 (4ft8 A:138-207)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1478577Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)
  6. 1478578Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
    N-terminal domain has double beta-helix fold
  7. 1478579Species Escherichia coli [TaxId:562] [46798] (26 PDB entries)
  8. 1478592Domain d4ft8a2: 4ft8 A:138-207 [229819]
    Other proteins in same PDB: d4ft8a1, d4ft8b1
    automated match to d1i5zb1
    complexed with cmp, co, so4

Details for d4ft8a2

PDB Entry: 4ft8 (more details), 1.97 Å

PDB Description: E. coli Catabolite Activator Protein with Cobalt and Sulfate Ligands
PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d4ft8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ft8a2 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

SCOPe Domain Coordinates for d4ft8a2:

Click to download the PDB-style file with coordinates for d4ft8a2.
(The format of our PDB-style files is described here.)

Timeline for d4ft8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ft8a1