SCOPe 2.08: Domain d4ft8b2: 4ft8 B:138-206

Lineage for d4ft8b2 (4ft8 B:138-206)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (28 PDB entries)

8. Domain d4ft8b2: 4ft8 B:138-206 [229818]
   Other proteins in same PDB: d4ft8a1, d4ft8b1
   automated match to d1i5za1
   complexed with cmp, co, so4

Details for d4ft8b2

PDB Entry: 4ft8, 1.97 Å

PDB Description: E. coli Catabolite Activator Protein with Cobalt and Sulfate Ligands

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d4ft8b2:

Sequence; same for both SEQRES and ATOM records:

>d4ft8b2 a.4.5.4 (B:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvy

Timeline for d4ft8b2:

• d4ft8b2 first appeared in SCOPe 2.03
  
• d4ft8b2 appears in SCOPe 2.07