Lineage for d4cfwc_ (4cfw C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672328Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1672329Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries)
    Uniprot P24941
  8. 1672709Domain d4cfwc_: 4cfw C: [229805]
    Other proteins in same PDB: d4cfwb1, d4cfwb2, d4cfwd1, d4cfwd2
    automated match to d1h1pa_
    complexed with sq9

Details for d4cfwc_

PDB Entry: 4cfw (more details), 2.45 Å

PDB Description: Structure-based design of C8-substituted O6-cyclohexylmethoxyguanine CDK1 and 2 inhibitors.
PDB Compounds: (C:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4cfwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cfwc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

SCOPe Domain Coordinates for d4cfwc_:

Click to download the PDB-style file with coordinates for d4cfwc_.
(The format of our PDB-style files is described here.)

Timeline for d4cfwc_: