SCOPe 2.06: Domain d4cfwb1: 4cfw B:175-309

Lineage for d4cfwb1 (4cfw B:175-309)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
   Uniprot P20248 175-432

8. Domain d4cfwb1: 4cfw B:175-309 [229790]
   Other proteins in same PDB: d4cfwa1, d4cfwa2, d4cfwc1, d4cfwc2
   automated match to d1h1pb1
   complexed with sq9

Details for d4cfwb1

PDB Entry: 4cfw, 2.45 Å

PDB Description: Structure-based design of C8-substituted O6-cyclohexylmethoxyguanine CDK1 and 2 inhibitors.

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4cfwb1:

Sequence; same for both SEQRES and ATOM records:

>d4cfwb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d4cfwb1:

• d4cfwb1 first appeared in SCOPe 2.03
  
• d4cfwb1 appears in SCOPe 2.05
  
• d4cfwb1 appears in SCOPe 2.07
  
• d4cfwb1 appears in the current release, SCOPe 2.08