SCOPe 2.08: Domain d4br6b2: 4br6 B:84-197

Lineage for d4br6b2 (4br6 B:84-197)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Chaetomium thermophilum [TaxId:209285] [229770] (1 PDB entry)

8. Domain d4br6b2: 4br6 B:84-197 [229771]
   Other proteins in same PDB: d4br6a1, d4br6b1, d4br6c1, d4br6d1
   automated match to d3qvna2
   complexed with gol, mn3, na

Details for d4br6b2

PDB Entry: 4br6, 2 Å

PDB Description: crystal structure of chaetomium thermophilum mnsod

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d4br6b2:

Sequence; same for both SEQRES and ATOM records:

>d4br6b2 d.44.1.0 (B:84-197) automated matches {Chaetomium thermophilum [TaxId: 209285]}
asregggepdgalkkaieadfgsfetfrkqmnaaltgiqgsgwawlakdkdsgnlaivtr
anqdpvtgqlvplmgidawehayylqyenrkaeyfeaiwnvinwktvaqrfeka

Timeline for d4br6b2:

• d4br6b2 first appeared in SCOPe 2.03
  
• d4br6b2 appears in SCOPe 2.07