Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Chaetomium thermophilum [TaxId:209285] [229770] (1 PDB entry) |
Domain d4br6b2: 4br6 B:84-197 [229771] Other proteins in same PDB: d4br6a1, d4br6b1, d4br6c1, d4br6d1 automated match to d3qvna2 complexed with gol, mn3, na |
PDB Entry: 4br6 (more details), 2 Å
SCOPe Domain Sequences for d4br6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4br6b2 d.44.1.0 (B:84-197) automated matches {Chaetomium thermophilum [TaxId: 209285]} asregggepdgalkkaieadfgsfetfrkqmnaaltgiqgsgwawlakdkdsgnlaivtr anqdpvtgqlvplmgidawehayylqyenrkaeyfeaiwnvinwktvaqrfeka
Timeline for d4br6b2: