Lineage for d3whdc1 (3whd C:61-215)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 2559898Domain d3whdc1: 3whd C:61-215 [229746]
    Other proteins in same PDB: d3whdc2
    automated match to d3whda_
    complexed with ca

Details for d3whdc1

PDB Entry: 3whd (more details), 2.29 Å

PDB Description: C-type lectin, human MCL
PDB Compounds: (C:) C-type lectin domain family 4 member D

SCOPe Domain Sequences for d3whdc1:

Sequence, based on SEQRES records: (download)

>d3whdc1 d.169.1.0 (C:61-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
haklkcikekselksaegstwnccpidwrafqsncyfpltdnktwaeserncsgmgahlm
tisteaeqnfiiqfldrrlsyflglrdenakgqwrwvdqtpfnprrvfwhknepdnsqge
ncvvlvynqdkwawndvpcnfeasrickipgttln

Sequence, based on observed residues (ATOM records): (download)

>d3whdc1 d.169.1.0 (C:61-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
haklkcikekstwnccpidwrafqsncyfpltdnktwaeserncsgmgahlmtisteaeq
nfiiqfldrrlsyflglrdenakgqwrwvdqtpfnprrvfwhknepdnsqgencvvlvyn
qdkwawndvpcnfeasrickipgttln

SCOPe Domain Coordinates for d3whdc1:

Click to download the PDB-style file with coordinates for d3whdc1.
(The format of our PDB-style files is described here.)

Timeline for d3whdc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3whdc2
View in 3D
Domains from other chains:
(mouse over for more information)
d3whda_