Lineage for d3w2ya_ (3w2y A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548661Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2548662Protein automated matches [190734] (13 species)
    not a true protein
  7. 2548670Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries)
  8. 2548675Domain d3w2ya_: 3w2y A: [229731]
    automated match to d1vyba_
    complexed with fmt, mg, peg; mutant

Details for d3w2ya_

PDB Entry: 3w2y (more details), 1.9 Å

PDB Description: crystal structure of dna uridine endonuclease mth212 mutant w205s
PDB Compounds: (A:) exodeoxyribonuclease

SCOPe Domain Sequences for d3w2ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w2ya_ d.151.1.0 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
tvlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfft
paerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseer
lkyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawi
dkfiengyvdtfrmfnsdpgqytswsyrtrarernvgwrldyffvneefkgkvkrswils
dvmgsdhcpigleiel

SCOPe Domain Coordinates for d3w2ya_:

Click to download the PDB-style file with coordinates for d3w2ya_.
(The format of our PDB-style files is described here.)

Timeline for d3w2ya_: