SCOPe 2.08: Domain d4nbzd_: 4nbz D:

Lineage for d4nbzd_ (4nbz D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)

8. Domain d4nbzd_: 4nbz D: [229717]
   automated match to d1oauh_

Details for d4nbzd_

PDB Entry: 4nbz, 1.75 Å

PDB Description: Crystal Structure of TcdA-A1 Bound to A26.8 VHH

PDB Compounds: (D:) a26.8 vhh

SCOPe Domain Sequences for d4nbzd_:

Sequence; same for both SEQRES and ATOM records:

>d4nbzd_ b.1.1.0 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vkleesggglvqaggslrlscaasertfsrypvawfrqapgaerefvavisstgtstyya
dsvkgrftisrdnakvtvylqmnnlkredtavyfcavnsqrtrlqdpneydywgqgtqvt
vss

Timeline for d4nbzd_:

• d4nbzd_ first appeared in SCOPe 2.03
  
• d4nbzd_ appears in SCOPe 2.07