Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (36 PDB entries) |
Domain d4mdkh_: 4mdk H: [229682] Other proteins in same PDB: d4mdka_, d4mdkb_, d4mdkc_, d4mdkd_ automated match to d4ap4f_ complexed with u94 |
PDB Entry: 4mdk (more details), 2.61 Å
SCOPe Domain Sequences for d4mdkh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mdkh_ d.15.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mgmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsd yniqkestlhlvlr
Timeline for d4mdkh_: