Lineage for d4lasl_ (4las L:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766904Domain d4lasl_: 4las L: [229665]
    Other proteins in same PDB: d4lash_
    automated match to d2dtgd1
    complexed with 1wf

Details for d4lasl_

PDB Entry: 4las (more details), 2.33 Å

PDB Description: crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
PDB Compounds: (L:) Single light chain Variable fragment

SCOPe Domain Sequences for d4lasl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lasl_ b.1.1.0 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ggggsqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiystsnl
asgvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikra

SCOPe Domain Coordinates for d4lasl_:

Click to download the PDB-style file with coordinates for d4lasl_.
(The format of our PDB-style files is described here.)

Timeline for d4lasl_: