Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries) |
Domain d4m17c1: 4m17 C:235-355 [229657] automated match to d1pwba1 complexed with ca; mutant |
PDB Entry: 4m17 (more details), 2.1 Å
SCOPe Domain Sequences for d4m17c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m17c1 d.169.1.1 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepndaggsedcveiftngkwndvacgekrlvvce f
Timeline for d4m17c1: