![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (6 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) mono-domain proteins |
![]() | Protein Azurin [49530] (6 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [49533] (33 PDB entries) |
![]() | Domain d5azuc_: 5azu C: [22965] |
PDB Entry: 5azu (more details), 1.9 Å
SCOP Domain Sequences for d5azuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5azuc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa} aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal mkgtltlk
Timeline for d5azuc_: