Lineage for d5azuc_ (5azu C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457650Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 457651Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 457652Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 457692Protein Azurin [49530] (6 species)
  7. 457722Species Pseudomonas aeruginosa [TaxId:287] [49533] (33 PDB entries)
  8. 457783Domain d5azuc_: 5azu C: [22965]

Details for d5azuc_

PDB Entry: 5azu (more details), 1.9 Å

PDB Description: crystal structure analysis of oxidized pseudomonas aeruginosa azurin at ph 5.5 and ph 9.0. a ph-induced conformational transition involves a peptide bond flip

SCOP Domain Sequences for d5azuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5azuc_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d5azuc_:

Click to download the PDB-style file with coordinates for d5azuc_.
(The format of our PDB-style files is described here.)

Timeline for d5azuc_: