SCOPe 2.03: Domain d4l5fe_: 4l5f E:

Lineage for d4l5fe_ (4l5f E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein automated matches [190183] (5 species)
   not a true protein

7. Species Dengue virus 1 [TaxId:11053] [195098] (4 PDB entries)

8. Domain d4l5fe_: 4l5f E: [229639]
   Other proteins in same PDB: d4l5fl1, d4l5fl2
   automated match to d4ffya_

Details for d4l5fe_

PDB Entry: 4l5f, 2.45 Å

PDB Description: crystal structure of denv1-e106 fab bound to denv-1 envelope protein diii

PDB Compounds: (E:) envelope protein

SCOPe Domain Sequences for d4l5fe_:

Sequence; same for both SEQRES and ATOM records:

>d4l5fe_ b.1.18.4 (E:) automated matches {Dengue virus 1 [TaxId: 11053]}
msyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanp
ivtdkekpvnieaeppfgesyivvgagekalklswfkk

Timeline for d4l5fe_:

• d4l5fe_ is new in SCOPe 2.03-stable
  
• d4l5fe_ appears in SCOPe 2.04
  
• d4l5fe_ appears in the current release, SCOPe 2.08