SCOPe 2.04: Domain d4cadd2: 4cad D:108-212

Lineage for d4cadd2 (4cad D:108-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d4cadd2: 4cad D:108-212 [229579]
   automated match to d4cadg2
   complexed with bog, lmt

Details for d4cadd2

PDB Entry: 4cad, 2.5 Å

PDB Description: mechanism of farnesylated caax protein processing by the integral membrane protease rce1

PDB Compounds: (D:) antibody fab fragment light chain

SCOPe Domain Sequences for d4cadd2:

Sequence; same for both SEQRES and ATOM records:

>d4cadd2 b.1.1.0 (D:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4cadd2:

• d4cadd2 first appeared in SCOPe 2.03
  
• d4cadd2 appears in SCOPe 2.05
  
• d4cadd2 appears in the current release, SCOPe 2.08