Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (52 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [228163] (12 PDB entries) |
Domain d4c6xb2: 4c6x B:260-416 [229554] automated match to d4c6wa2 complexed with edo, epe, k, m7u, tlm |
PDB Entry: 4c6x (more details), 1.95 Å
SCOPe Domain Sequences for d4c6xb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c6xb2 c.95.1.0 (B:260-416) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} kplarllgagitsdafhmvapaadgvragramtrslelaglspadidhvnahgtatpigd aaeanairvagcdqaavyapksalghsigavgalesvltvltlrdgvipptlnyetpdpe idldvvageprygdyryavnnsfgfgghnvalafgry
Timeline for d4c6xb2: