SCOPe 2.08: Domain d4gw1c1: 4gw1 C:1-107

Lineage for d4gw1c1 (4gw1 C:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Murinae, homo sapiens [TaxId:39107] [228174] (2 PDB entries)

8. Domain d4gw1c1: 4gw1 C:1-107 [229500]
   Other proteins in same PDB: d4gw1a2, d4gw1c2
   automated match to d1g9ml1
   complexed with po4

Details for d4gw1c1

PDB Entry: 4gw1, 2.24 Å

PDB Description: cqfd meditope

PDB Compounds: (C:) Fab light chain

SCOPe Domain Sequences for d4gw1c1:

Sequence; same for both SEQRES and ATOM records:

>d4gw1c1 b.1.1.0 (C:1-107) automated matches {Murinae, homo sapiens [TaxId: 39107]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelk

Timeline for d4gw1c1:

• d4gw1c1 first appeared in SCOPe 2.03
  
• d4gw1c1 appears in SCOPe 2.07