Lineage for d4jfxa1 (4jfx A:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032444Domain d4jfxa1: 4jfx A:1-107 [229490]
    Other proteins in same PDB: d4jfxa2, d4jfxl2
    automated match to d4jfzl1
    complexed with pg4

Details for d4jfxa1

PDB Entry: 4jfx (more details), 1.95 Å

PDB Description: structure of phosphotyrosine (ptyr) scaffold bound to ptyr peptide
PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d4jfxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jfxa1 b.1.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa
rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveik

SCOPe Domain Coordinates for d4jfxa1:

Click to download the PDB-style file with coordinates for d4jfxa1.
(The format of our PDB-style files is described here.)

Timeline for d4jfxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jfxa2