Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Escherichia coli [TaxId:562] [224856] (13 PDB entries) |
Domain d4jfxa1: 4jfx A:1-107 [229490] Other proteins in same PDB: d4jfxa2, d4jfxl2 automated match to d4jfzl1 complexed with pg4 |
PDB Entry: 4jfx (more details), 1.95 Å
SCOPe Domain Sequences for d4jfxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jfxa1 b.1.1.0 (A:1-107) automated matches {Escherichia coli [TaxId: 562]} divltqspatlslspgeratlscmtstdidddmnwyqqkpgqaprllisegntlrpgvpa rfsgsgsgtdftltisslepedfavyyclqsfnvpltfgqgtkveik
Timeline for d4jfxa1: