SCOPe 2.05: Domain d3zngb_: 3zng B:

Lineage for d3zngb_ (3zng B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein Elongin C [54699] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries)

8. Domain d3zngb_: 3zng B: [229478]
   Other proteins in same PDB: d3zngc_, d3zngf_
   automated match to d2c9wc_
   complexed with edo

Details for d3zngb_

PDB Entry: 3zng, 2.85 Å

PDB Description: Ankyrin repeat and SOCS-box protein 9 (ASB9) in complex with ElonginB and ElonginC

PDB Compounds: (B:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d3zngb_:

Sequence, based on SEQRES records:

>d3zngb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmyf
tykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records):

>d3zngb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsst
eipefpiapeialellmaanfldc

Timeline for d3zngb_:

• d3zngb_ first appeared in SCOPe 2.03
  
• d3zngb_ appears in SCOPe 2.04
  
• d3zngb_ appears in SCOPe 2.06
  
• d3zngb_ appears in the current release, SCOPe 2.08