Lineage for d3zc9a_ (3zc9 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2062236Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2062365Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2062366Protein automated matches [190445] (6 species)
    not a true protein
  7. 2062417Species Murraya koenigii [TaxId:311449] [189153] (3 PDB entries)
  8. 2062418Domain d3zc9a_: 3zc9 A: [229465]
    automated match to d3iira_

Details for d3zc9a_

PDB Entry: 3zc9 (more details), 2.24 Å

PDB Description: Crystal Structure of Murraya koenigii Miraculin-Like Protein at 2.2 A resolution at pH 4.6
PDB Compounds: (A:) trypsin inhibitor

SCOPe Domain Sequences for d3zc9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zc9a_ b.42.4.0 (A:) automated matches {Murraya koenigii [TaxId: 311449]}
dplldingnvveasrdyylvsviggaggggltlyrgrnelcpldviqlspdlhkgtrlrf
aaynntsiiheavdlnvkfstetscneptvwrvdnydpsrgkwfittggvegnpgaqtlk
nwfklervgtdqgtyeivhcpsvckscvflcndvgvsydyrrrlaltagnervfgvvivp
an

SCOPe Domain Coordinates for d3zc9a_:

Click to download the PDB-style file with coordinates for d3zc9a_.
(The format of our PDB-style files is described here.)

Timeline for d3zc9a_: