Lineage for d4i5bd2 (4i5b D:82-188)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291899Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1291907Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 1291922Domain d4i5bd2: 4i5b D:82-188 [229425]
    Other proteins in same PDB: d4i5ba1, d4i5bb1, d4i5bb2, d4i5bd1, d4i5be1, d4i5be2
    automated match to d1fv1a1

Details for d4i5bd2

PDB Entry: 4i5b (more details), 2.12 Å

PDB Description: structure of human mhc class ii protein hla-dr1 carrying an influenza hemagglutinin peptide partially filling the binding groove
PDB Compounds: (D:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d4i5bd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5bd2 b.1.1.2 (D:82-188) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefdapsplpe

SCOPe Domain Coordinates for d4i5bd2:

Click to download the PDB-style file with coordinates for d4i5bd2.
(The format of our PDB-style files is described here.)

Timeline for d4i5bd2: