Lineage for d3wg4a1 (3wg4 A:0-160)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780663Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries)
  8. 2780668Domain d3wg4a1: 3wg4 A:0-160 [229347]
    Other proteins in same PDB: d3wg4a2, d3wg4a3, d3wg4b2
    automated match to d1ww4a_
    complexed with peg; mutant

Details for d3wg4a1

PDB Entry: 3wg4 (more details), 1.6 Å

PDB Description: crystal structure of agrocybe cylindracea galectin mutant (n46a) with blood type a antigen tetraose
PDB Compounds: (A:) Galactoside-binding lectin

SCOPe Domain Sequences for d3wg4a1:

Sequence, based on SEQRES records: (download)

>d3wg4a1 b.29.1.0 (A:0-160) automated matches {Agrocybe cylindracea [TaxId: 64608]}
hmttsavniynisagasvdlaapvttgdivtffssalnlsagagspantalnllsengay
llhiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvin
ektviqytkqisgttsslsynstegtsifstvveavtytgl

Sequence, based on observed residues (ATOM records): (download)

>d3wg4a1 b.29.1.0 (A:0-160) automated matches {Agrocybe cylindracea [TaxId: 64608]}
hmttsavniynisagasvdlaapvttgdivtffssalnlsgspantalnllsengayllh
iafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinekt
viqytkqisgttsslsynstgtsifstvveavtytgl

SCOPe Domain Coordinates for d3wg4a1:

Click to download the PDB-style file with coordinates for d3wg4a1.
(The format of our PDB-style files is described here.)

Timeline for d3wg4a1: