SCOPe 2.08: Domain d4nb6b_: 4nb6 B:

Lineage for d4nb6b_ (4nb6 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d4nb6b_: 4nb6 B: [229343]
   automated match to d3l0la_
   complexed with 444

Details for d4nb6b_

PDB Entry: 4nb6, 2.85 Å

PDB Description: Crystal structure of the ligand binding domain of RORC with T0901317

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4nb6b_:

Sequence; same for both SEQRES and ATOM records:

>d4nb6b_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
lelafhhhlckthrqsilaklppkgklrslcsqhverlqifq

Timeline for d4nb6b_:

• d4nb6b_ first appeared in SCOPe 2.03
  
• d4nb6b_ appears in SCOPe 2.07